Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337332.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
FPDFFFSISCVHKMATSEVEVERSDVQLKHLGFVRVLAINAAVVVSNLYSYAKENSGTLKSTVGKVENAVATVVGPVYDRFQGVPGHILVFLDIKVDEAAQKFNECAPPAAKIAASKGQS IASTTSHLLQELVEEAKVDGPLAAVFHAGQISKAAAINGVALVWYKANHYPALHGVLEMAVPTAAHWSEKYNSIVKDLAAKGYSSFSYVPLVPVEEMEKAYKQVEAASDKKTDSGSSSQS D | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 12,791.873 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 39.331 | ||
aromaticity | 0.078 | ||
GRAVY | 0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.200 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337332.1 | 5prime_partial | 115 | 723-376(-) |
Amino Acid sequence : | |||
IALAGAAGIGLLITGSLHLLICLLHLLHRHQRNVAERTVPLGRQVFNDAVVLLRPMCSCWNSHLQHSVQRRVVVGFVPHESYPIYCGCLGDLASVEDGCQWTVDFGFLDKFLQKM* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,791.873 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 39.331 | ||
aromaticity | 0.078 | ||
GRAVY | 0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.200 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337332.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
FPDFFFSISCVHKMATSEVEVERSDVQLKHLGFVRVLAINAAVVVSNLYSYAKENSGTLKSTVGKVENAVATVVGPVYDRFQGVPGHILVFLDIKVDEAAQKFNECAPPAAKIAASKGQS IASTTSHLLQELVEEAKVDGPLAAVFHAGQISKAAAINGVALVWYKANHYPALHGVLEMAVPTAAHWSEKYNSIVKDLAAKGYSSFSYVPLVPVEEMEKAYKQVEAASDKKTDSGSSSQS D | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 12,791.873 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 39.331 | ||
aromaticity | 0.078 | ||
GRAVY | 0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.200 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337332.1 | 5prime_partial | 115 | 723-376(-) |
Amino Acid sequence : | |||
IALAGAAGIGLLITGSLHLLICLLHLLHRHQRNVAERTVPLGRQVFNDAVVLLRPMCSCWNSHLQHSVQRRVVVGFVPHESYPIYCGCLGDLASVEDGCQWTVDFGFLDKFLQKM* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,791.873 | ||
Theoretical pI: | 7.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 39.331 | ||
aromaticity | 0.078 | ||
GRAVY | 0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.200 | ||
sheet | 0.261 |