| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337337.1 | 5prime_partial | 200 | 667-65(-) |
Amino Acid sequence : | |||
| TYMASLPNMVVMAPSDEAELMHMIATAAIIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLGKE HEILITVEEGSIGGFSAHVSHFLSLNELLDGNLKWRPMVLPDRYIEHGGHPDQIEEAGLSSKHIAATVLSLLVNEKKVFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,463.534 | ||
| Theoretical pI: | 5.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 32.776 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.265 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337337.1 | 5prime_partial | 200 | 667-65(-) |
Amino Acid sequence : | |||
| TYMASLPNMVVMAPSDEAELMHMIATAAIIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLIKNLGKE HEILITVEEGSIGGFSAHVSHFLSLNELLDGNLKWRPMVLPDRYIEHGGHPDQIEEAGLSSKHIAATVLSLLVNEKKVFI* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 21,463.534 | ||
| Theoretical pI: | 5.727 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 32.776 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.037 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.265 | ||
| sheet | 0.305 | ||