| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337341.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
| TSNPVLLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN DSVTKSKFDNLYGCRHSLPDGLMRAT | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 26,944.035 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.647 | ||
| aromaticity | 0.019 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.288 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337341.1 | 5prime_partial | 260 | 799-17(-) |
Amino Acid sequence : | |||
| SSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVH DEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVL DLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 26,944.035 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.647 | ||
| aromaticity | 0.019 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.288 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337341.1 | internal | 266 | 2-799(+) |
Amino Acid sequence : | |||
| TSNPVLLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWK GETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVN DSVTKSKFDNLYGCRHSLPDGLMRAT | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 26,944.035 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.647 | ||
| aromaticity | 0.019 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.288 | ||
| sheet | 0.323 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337341.1 | 5prime_partial | 260 | 799-17(-) |
Amino Acid sequence : | |||
| SSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVH DEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVL DLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 260 | ||
| Molecular weight: | 26,944.035 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 43.647 | ||
| aromaticity | 0.019 | ||
| GRAVY | 0.020 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.288 | ||
| sheet | 0.323 | ||