Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337347.1	5prime_partial	142	482-54(-)
Amino Acid sequence :
SSKDQTQSNGASSSTDPNQQSSTPKSSSTVKRAPLTARERLRAARVLNRYTDTKPSKPKLNSRLLDALQESDKGKKRPGLPEAPTNLFDDSKRGMPKEGWTIDLPGGMDVFFIAVSFVLI STVMFATTYIVWKVGAKRFNEY*
Physicochemical properties
Number of amino acids:		142
Molecular weight:		13,352.337
Theoretical pI:		7.806
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		32.540
aromaticity		0.088
GRAVY		0.456
Secondary Structure Fraction
Helix		0.368
turn		0.312
sheet		0.272

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337347.1	complete	125	94-471(+)
Amino Acid sequence :
MYVVANITVLISTNETAMKKTSIPPGRSMVHPSFGIPLLLSSNKFVGASGRPGRFFPLSDSCRASSSRLLSLGLDGFVSVYRLSTLAALSLSRAVNGALFTVELDLGVDDCWFGSVELLA PLDWV*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		13,352.337
Theoretical pI:		7.806
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		32.540
aromaticity		0.088
GRAVY		0.456
Secondary Structure Fraction
Helix		0.368
turn		0.312
sheet		0.272