| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337350.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| DXGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTGAGLVGPVTYLLLSKPAKG VEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLGLDLEPYQLDAF | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,903.345 | ||
| Theoretical pI: | 4.866 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
| Instability index: | 18.429 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.246 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337350.1 | internal | 172 | 1-516(+) |
Amino Acid sequence : | |||
| DXGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTGAGLVGPVTYLLLSKPAKG VEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLGLDLEPYQLDAF | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,903.345 | ||
| Theoretical pI: | 4.866 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
| Instability index: | 18.429 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.246 | ||
| sheet | 0.275 | ||