Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337353.1 | complete | 186 | 222-782(+) |
Amino Acid sequence : | |||
MPKFPATVLTHPNISHAFFSLSGDIAAADAATLPPNSSTGGTLEATFERIIITPAKTATPLTLSIFAYGSIISHHPLEIPVLLNPSIVMNIPQKNINSGYDTFSREGIMRASATVIAVHD ISRPANNDISIPNVTTYTHPFHTILFLFLEYPSLSSANVAKLSLSEGASFRNYNPISCYTTVWINT* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 17,246.288 | ||
Theoretical pI: | 4.761 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
Instability index: | 35.008 | ||
aromaticity | 0.085 | ||
GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.273 | ||
sheet | 0.297 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337353.1 | complete | 165 | 652-155(-) |
Amino Acid sequence : | |||
MVWKGCVYVVTLGMLISLLAGLDMSWTAITVALALMMPSLEKVSYPLLIFFCGMFITIDGFNRTGISSGWWEMMEPYAKIDSVSGVAVLAGVIIILSNVASNVPPVLLLGGRVAASAAAI SPESEKKAWLILGWVSTVAGNFGIECCVRVGAADQSGCVGEGVPG* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 17,246.288 | ||
Theoretical pI: | 4.761 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
Instability index: | 35.008 | ||
aromaticity | 0.085 | ||
GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
Helix | 0.388 | ||
turn | 0.273 | ||
sheet | 0.297 |