| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337353.1 | complete | 186 | 222-782(+) |
Amino Acid sequence : | |||
| MPKFPATVLTHPNISHAFFSLSGDIAAADAATLPPNSSTGGTLEATFERIIITPAKTATPLTLSIFAYGSIISHHPLEIPVLLNPSIVMNIPQKNINSGYDTFSREGIMRASATVIAVHD ISRPANNDISIPNVTTYTHPFHTILFLFLEYPSLSSANVAKLSLSEGASFRNYNPISCYTTVWINT* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 17,246.288 | ||
| Theoretical pI: | 4.761 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
| Instability index: | 35.008 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.273 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337353.1 | complete | 165 | 652-155(-) |
Amino Acid sequence : | |||
| MVWKGCVYVVTLGMLISLLAGLDMSWTAITVALALMMPSLEKVSYPLLIFFCGMFITIDGFNRTGISSGWWEMMEPYAKIDSVSGVAVLAGVIIILSNVASNVPPVLLLGGRVAASAAAI SPESEKKAWLILGWVSTVAGNFGIECCVRVGAADQSGCVGEGVPG* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 17,246.288 | ||
| Theoretical pI: | 4.761 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
| Instability index: | 35.008 | ||
| aromaticity | 0.085 | ||
| GRAVY | 0.885 | ||
Secondary Structure Fraction | |||
| Helix | 0.388 | ||
| turn | 0.273 | ||
| sheet | 0.297 | ||