| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337358.1 | 3prime_partial | 156 | 98-565(+) |
Amino Acid sequence : | |||
| MDYTGIVAEDPIQLTGANCFFLGDAFVLFKSVNGVMKGVSVVDNMFAGSDKGVDIVQLDQSNGVFRQVDEVSIHKNSVRGMTMKTTVASATVEGNGTSWTADFKKALVFPDLIKQVQYTF VADTASFPQHFVRNISDNTLVVQSDVAVPARVYITA | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,891.997 | ||
| Theoretical pI: | 4.957 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 9.070 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.218 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337358.1 | 3prime_partial | 156 | 98-565(+) |
Amino Acid sequence : | |||
| MDYTGIVAEDPIQLTGANCFFLGDAFVLFKSVNGVMKGVSVVDNMFAGSDKGVDIVQLDQSNGVFRQVDEVSIHKNSVRGMTMKTTVASATVEGNGTSWTADFKKALVFPDLIKQVQYTF VADTASFPQHFVRNISDNTLVVQSDVAVPARVYITA | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 16,891.997 | ||
| Theoretical pI: | 4.957 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 9.070 | ||
| aromaticity | 0.096 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.218 | ||
| sheet | 0.179 | ||