| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337365.1 | internal | 226 | 2-679(+) |
Amino Acid sequence : | |||
| HHVKVCLPNSIKMALPLSHLTTKQSPPIQALSTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIH LMHAAAHAHEHLPLTDGSRPDYKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVC | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 17,566.819 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 99.715 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.331 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337365.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
| APRKGLPPQFNQNGSTSLPPHHQTKSPHPSTINIPPPTAAVHGHRRRRRRESIILGHHPGRHKFVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLRGGLRAHRRPPEPSHRRRLRHT PHACGGPRPRAPPPHRRLQARLQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,566.819 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 99.715 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.331 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337365.1 | internal | 226 | 2-679(+) |
Amino Acid sequence : | |||
| HHVKVCLPNSIKMALPLSHLTTKQSPPIQALSTFRRPPPPCMATAVAVAGNQSYWDTIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIH LMHAAAHAHEHLPLTDGSRPDYKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVC | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 17,566.819 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 99.715 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.331 | ||
| sheet | 0.169 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337365.1 | 5prime_partial | 154 | 1-465(+) |
Amino Acid sequence : | |||
| APRKGLPPQFNQNGSTSLPPHHQTKSPHPSTINIPPPTAAVHGHRRRRRRESIILGHHPGRHKFVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLRGGLRAHRRPPEPSHRRRLRHT PHACGGPRPRAPPPHRRLQARLQARYPTQVQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,566.819 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 99.715 | ||
| aromaticity | 0.019 | ||
| GRAVY | -1.388 | ||
Secondary Structure Fraction | |||
| Helix | 0.143 | ||
| turn | 0.331 | ||
| sheet | 0.169 | ||