| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337385.1 | 5prime_partial | 177 | 553-20(-) |
Amino Acid sequence : | |||
| VFGAVVASLIPGVNVINMLLLGFGIWKDEATVKSMTRHGDHRELLKGPLYYATGLSLFTAIYWRSSPIAIAAYCNVCAGDGVADIAGRRLGSRRLPYNKSKSFAGTIAMFFAGFLAFIGS TQNFSWFGYIEASWRLGVGFLVISVASAFVESLPISTDLDDNFTVPLAVLLVGTLVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,084.968 | ||
| Theoretical pI: | 8.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 25.793 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.407 | ||
| turn | 0.254 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337385.1 | 5prime_partial | 177 | 553-20(-) |
Amino Acid sequence : | |||
| VFGAVVASLIPGVNVINMLLLGFGIWKDEATVKSMTRHGDHRELLKGPLYYATGLSLFTAIYWRSSPIAIAAYCNVCAGDGVADIAGRRLGSRRLPYNKSKSFAGTIAMFFAGFLAFIGS TQNFSWFGYIEASWRLGVGFLVISVASAFVESLPISTDLDDNFTVPLAVLLVGTLVF* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,084.968 | ||
| Theoretical pI: | 8.637 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 25.793 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.621 | ||
Secondary Structure Fraction | |||
| Helix | 0.407 | ||
| turn | 0.254 | ||
| sheet | 0.260 | ||