Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337392.1 | 5prime_partial | 174 | 3-527(+) |
Amino Acid sequence : | |||
TPFRSGFFRLPNDIPFPIWRYPVMYMSFHYWSLQGQYQNHLKGLMFDDLSPDNPKIPGEFILENIFEIDIERSKWVDLSVLFSMIFIYRLLFFLIIKLNENATPRIRAYVAKQRMQHINN NNKKYNNINNNTNHCAEISVSPTPSHDLHPPPPPPTEASSTSDSNVADSHAVST* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 20,210.710 | ||
Theoretical pI: | 6.614 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 54.556 | ||
aromaticity | 0.126 | ||
GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.310 | ||
sheet | 0.184 |