| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337392.1 | 5prime_partial | 174 | 3-527(+) |
Amino Acid sequence : | |||
| TPFRSGFFRLPNDIPFPIWRYPVMYMSFHYWSLQGQYQNHLKGLMFDDLSPDNPKIPGEFILENIFEIDIERSKWVDLSVLFSMIFIYRLLFFLIIKLNENATPRIRAYVAKQRMQHINN NNKKYNNINNNTNHCAEISVSPTPSHDLHPPPPPPTEASSTSDSNVADSHAVST* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 20,210.710 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 54.556 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.310 | ||
| sheet | 0.184 | ||