| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337394.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
| WQIIQTLKGITCKAAVAWKPSEPLVVEEICPEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLRAVGLGAVSASRILGASKIIGI | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 12,051.850 | ||
| Theoretical pI: | 9.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 55.648 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337394.1 | 3prime_partial | 113 | 339-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSGQISSTTSGSDGFHATAALHVMPLRVCIICH | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,051.850 | ||
| Theoretical pI: | 9.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 55.648 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337394.1 | internal | 224 | 2-673(+) |
Amino Acid sequence : | |||
| WQIIQTLKGITCKAAVAWKPSEPLVVEEICPEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPG IAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLRAVGLGAVSASRILGASKIIGI | |||
Physicochemical properties | |||
| Number of amino acids: | 224 | ||
| Molecular weight: | 12,051.850 | ||
| Theoretical pI: | 9.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 55.648 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337394.1 | 3prime_partial | 113 | 339-1(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSGQISSTTSGSDGFHATAALHVMPLRVCIICH | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,051.850 | ||
| Theoretical pI: | 9.149 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 55.648 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.319 | ||
| sheet | 0.186 | ||