| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337396.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| PWQIIQMLRELTCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPP GIAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKR | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 11,986.664 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.092 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.327 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337396.1 | 3prime_partial | 113 | 341-3(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVSSLSICIICH | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,986.664 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.092 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.327 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337396.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| PWQIIQMLRELTCKAAVAWKPSEPLVVEEICVEPPKSTEVRIKMLAASMCHTDILLWKGFPLPLYPRIPGHEGAGVIESVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPP GIAGLMPDGTSRMSAKGQKLYHMFSCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFMTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSASRILGASKIIGIDVNELKR | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 11,986.664 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.092 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.327 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337396.1 | 3prime_partial | 113 | 341-3(-) |
Amino Acid sequence : | |||
| MFVFPVAQFEHSPHSPMESGITVSPTLRFVTFSPTLSITPAPSCPGIRGYRGRGKPFQSRISVWHMLAASILILTSVDLGGSTQISSTTSGSDGFHATAALHVSSLSICIICH | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,986.664 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 51.092 | ||
| aromaticity | 0.080 | ||
| GRAVY | 0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.327 | ||
| sheet | 0.177 | ||