Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337405.1 | complete | 137 | 47-460(+) |
Amino Acid sequence : | |||
MPPEYAQYGDVSPKVDVYAFGVVIYELISAKEAIVKENGNAADSRGLVALFEEALSEAEPTEALKKLVDPRLGDNYPLESAMKVAQLARACTHENPQLRPSMRSIVVALMTLSSSTDNWD VGHFYGNQGLINLMSGR* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,959.820 | ||
Theoretical pI: | 4.849 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 40.210 | ||
aromaticity | 0.073 | ||
GRAVY | -0.157 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.255 | ||
sheet | 0.328 |