| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337406.1 | 5prime_partial | 152 | 474-16(-) |
Amino Acid sequence : | |||
| TRSLPTGRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVIYELISAKEAIVKENGNAADSRGLVALFEEALSEAEPTEALKKLVDPRLGDNYPLESAMKVAQLARACTHENPQLRPSMRSI VVALMTLSSSTDNWDVGRFYGNQGLINLMSGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,585.689 | ||
| Theoretical pI: | 5.196 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 43.538 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.263 | ||
| sheet | 0.309 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337406.1 | 5prime_partial | 152 | 474-16(-) |
Amino Acid sequence : | |||
| TRSLPTGRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVIYELISAKEAIVKENGNAADSRGLVALFEEALSEAEPTEALKKLVDPRLGDNYPLESAMKVAQLARACTHENPQLRPSMRSI VVALMTLSSSTDNWDVGRFYGNQGLINLMSGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,585.689 | ||
| Theoretical pI: | 5.196 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 43.538 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.263 | ||
| sheet | 0.309 | ||