Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337406.1 | 5prime_partial | 152 | 474-16(-) |
Amino Acid sequence : | |||
TRSLPTGRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVIYELISAKEAIVKENGNAADSRGLVALFEEALSEAEPTEALKKLVDPRLGDNYPLESAMKVAQLARACTHENPQLRPSMRSI VVALMTLSSSTDNWDVGRFYGNQGLINLMSGR* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,585.689 | ||
Theoretical pI: | 5.196 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 43.538 | ||
aromaticity | 0.079 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.263 | ||
sheet | 0.309 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337406.1 | 5prime_partial | 152 | 474-16(-) |
Amino Acid sequence : | |||
TRSLPTGRLVGTFGYMPPEYAQYGDVSPKVDVYAFGVVIYELISAKEAIVKENGNAADSRGLVALFEEALSEAEPTEALKKLVDPRLGDNYPLESAMKVAQLARACTHENPQLRPSMRSI VVALMTLSSSTDNWDVGRFYGNQGLINLMSGR* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,585.689 | ||
Theoretical pI: | 5.196 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 43.538 | ||
aromaticity | 0.079 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.263 | ||
sheet | 0.309 |