| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337407.1 | 3prime_partial | 127 | 280-660(+) |
Amino Acid sequence : | |||
| MEPNEGTFILHSEASKKGKIKPVHVIDVPGHSRLRLKLDEFLSRAAGIVFVVDAVEFLPNVRAVSEYLYDILTKESVVKKKIPLLLLCNKVDKVTAHSKDFIRRQLEKEINKLRASRTAV SSADISN | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 11,311.699 | ||
| Theoretical pI: | 9.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.918 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337407.1 | 5prime_partial | 103 | 659-348(-) |
Amino Acid sequence : | |||
| LLISAEDTAVLDARSLLISFSSCLRMKSFECAVTLSTLLHSSSNGIFFFTTLSLVRISYRYSETARTFGRNSTASTTKTMPAARDKNSSSLSRSREWPGTSIT* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,311.699 | ||
| Theoretical pI: | 9.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.918 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337407.1 | 3prime_partial | 127 | 280-660(+) |
Amino Acid sequence : | |||
| MEPNEGTFILHSEASKKGKIKPVHVIDVPGHSRLRLKLDEFLSRAAGIVFVVDAVEFLPNVRAVSEYLYDILTKESVVKKKIPLLLLCNKVDKVTAHSKDFIRRQLEKEINKLRASRTAV SSADISN | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 11,311.699 | ||
| Theoretical pI: | 9.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.918 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337407.1 | 5prime_partial | 103 | 659-348(-) |
Amino Acid sequence : | |||
| LLISAEDTAVLDARSLLISFSSCLRMKSFECAVTLSTLLHSSSNGIFFFTTLSLVRISYRYSETARTFGRNSTASTTKTMPAARDKNSSSLSRSREWPGTSIT* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,311.699 | ||
| Theoretical pI: | 9.884 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 44.918 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.252 | ||