| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337418.1 | 5prime_partial | 188 | 688-122(-) |
Amino Acid sequence : | |||
| KEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRPDKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTN PLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLVEKYAADEDAFFTDYAEAHLKLSELGFPDP* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,742.937 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.901 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.255 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337418.1 | 5prime_partial | 188 | 688-122(-) |
Amino Acid sequence : | |||
| KEELAHGANNGLDIALRLLEPIRDQFPTLSFADFYQLAGVVAVEVTGGPEVPFHPGRPDKPEPPVEGRLPDATQGSDHLRQVFTKQMGLNDQDIVALSGGHTLGRCHKERSGFEGPWTTN PLIFDNSYFKELLSGEKEGLLQLPTDKTLLSDPSFRPLVEKYAADEDAFFTDYAEAHLKLSELGFPDP* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 20,742.937 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.901 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.255 | ||
| sheet | 0.287 | ||