| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337419.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| AAVSAAIPRLSNGGDPSGTYSSPSGAHRHSLFHLPSRGFASDSITPKNEDSSIPQVPPTLAAIKNPTPKIVYDEHNHERYRPCDPSKRAFAYFVLTGGRFVYASLARLLILKFVLSMSAS KDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDVKLANSVNLGSLRDPQEDSERVKN | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 16,554.758 | ||
| Theoretical pI: | 10.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.509 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.305 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337419.1 | 5prime_partial | 151 | 553-98(-) |
Amino Acid sequence : | |||
| FFTLSESSCGSRRLPRLTLFANFTSSSVLLLMNTGFPRHFTVTVVPGSMLDRSTSREARARTSLLADMLRTNFSISSRAREAYTNLPPVNTKYANARLLGSHGLYRSWLCSSYTIFGVGF FIAASVGGTCGMELSSFFGVIESEAKPLEGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,554.758 | ||
| Theoretical pI: | 10.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.509 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.305 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337419.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| AAVSAAIPRLSNGGDPSGTYSSPSGAHRHSLFHLPSRGFASDSITPKNEDSSIPQVPPTLAAIKNPTPKIVYDEHNHERYRPCDPSKRAFAYFVLTGGRFVYASLARLLILKFVLSMSAS KDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDVKLANSVNLGSLRDPQEDSERVKN | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 16,554.758 | ||
| Theoretical pI: | 10.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.509 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.305 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337419.1 | 5prime_partial | 151 | 553-98(-) |
Amino Acid sequence : | |||
| FFTLSESSCGSRRLPRLTLFANFTSSSVLLLMNTGFPRHFTVTVVPGSMLDRSTSREARARTSLLADMLRTNFSISSRAREAYTNLPPVNTKYANARLLGSHGLYRSWLCSSYTIFGVGF FIAASVGGTCGMELSSFFGVIESEAKPLEGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,554.758 | ||
| Theoretical pI: | 10.032 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.509 | ||
| aromaticity | 0.113 | ||
| GRAVY | 0.077 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.305 | ||
| sheet | 0.265 | ||