| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337420.1 | 5prime_partial | 202 | 664-56(-) |
Amino Acid sequence : | |||
| KNPPPQIVYDEHNHERSRPGDPSKRAFAYFVLPGGRFVYASLARLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDVKLANSVNLGSLRDPQEDSERVK NPEWLVVVGVCTHLGCIPLPNAGDFGGWFCPCHGSHYDISGRIRKGPAPYNLEVPPYSFLDENKLLIARPEQEGRCSSFQFM* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 15,006.948 | ||
| Theoretical pI: | 10.477 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 41.890 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.321 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337420.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| TKMMYSIYINICGYIIQDSHKLKRRASSFLFWSGNQQLVLIQETIWRNFKIVRSRTLSNSPRYIIMRAMAGTKPSSKITRIRQRNATQMRAHPDHNEPLRILHPLRVLLRVTKTPQINTV CQLHILFSPPPDEYWLSTPLHGHSGTRFDAGQIHLEGSQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 15,006.948 | ||
| Theoretical pI: | 10.477 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 41.890 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.321 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337420.1 | 3prime_partial | 137 | 255-665(+) |
Amino Acid sequence : | |||
| MQPKCVHTPTTTSHSGFFTLSESSCGSRRLPRLTLFANFTSSSVLLLMNTGFPRHFTVTVVPGSMLDRSTSREARARTSLLADMLRTNFSISSRAREAYTNLPPGNTKYANARLLGSPGL DRSWLCSSYTICGGGFF | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 15,006.948 | ||
| Theoretical pI: | 10.477 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 41.890 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.321 | ||
| sheet | 0.226 | ||