Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337424.1 | complete | 151 | 59-514(+) |
Amino Acid sequence : | |||
MKAEEMEAVFGGAMQSMRMTYYPPCPQPELAIGLSPHSDVSTITILLQVNDTDGLQIRKDGAWIPVSPLPDAFIVNIGDALEIVSNGAYRSIEHRACVNGDRERMSVATFVHPKVDGEVG PAASLVGPETPAKFGRIGAAEYLKGIFFQGA* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 13,916.596 | ||
Theoretical pI: | 10.953 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 79.349 | ||
aromaticity | 0.059 | ||
GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.261 | ||
sheet | 0.185 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337424.1 | complete | 119 | 538-179(-) |
Amino Acid sequence : | |||
MTSRYDFPLSSLEKNPLQILSRTDSPELRRSFRPHQARRRPYFSVHLRMHKRRHRHPLPIPIHTRSMLDTPVSSVAHDLQGIPNVDDERIGQRGDWNPGAIFSDLEAVGVVHLQQNRDR* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,916.596 | ||
Theoretical pI: | 10.953 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 79.349 | ||
aromaticity | 0.059 | ||
GRAVY | -0.864 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.261 | ||
sheet | 0.185 |