| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337432.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| FMGTKTSAPLKGTGAPAPSPARVPNYGMEPGSPTTPPARQAPSPAKPLPSTARLSIDELKRKTKSLLEEYFSVRLLDEALQCVEELKSPSYHSEIIKEAISLGLEKSPPCVEPVAKLLDY LFAKKVVSGADIATGCLQYAELLEDLAIDLPKAPANFGEIIGKLVLAGALEFKVVREILAKVGDDYYQKAVFRGVMKIVSSD | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 21,713.990 | ||
| Theoretical pI: | 6.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 46.659 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337432.1 | internal | 202 | 2-607(+) |
Amino Acid sequence : | |||
| FMGTKTSAPLKGTGAPAPSPARVPNYGMEPGSPTTPPARQAPSPAKPLPSTARLSIDELKRKTKSLLEEYFSVRLLDEALQCVEELKSPSYHSEIIKEAISLGLEKSPPCVEPVAKLLDY LFAKKVVSGADIATGCLQYAELLEDLAIDLPKAPANFGEIIGKLVLAGALEFKVVREILAKVGDDYYQKAVFRGVMKIVSSD | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 21,713.990 | ||
| Theoretical pI: | 6.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 46.659 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||