| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337443.1 | internal | 225 | 1-675(+) |
Amino Acid sequence : | |||
| DKEVELHAHPWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKRGTP LYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVHFVGGDMFESL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 14,139.772 | ||
| Theoretical pI: | 11.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 76.085 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337443.1 | complete | 125 | 420-43(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPPFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,139.772 | ||
| Theoretical pI: | 11.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 76.085 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337443.1 | internal | 225 | 1-675(+) |
Amino Acid sequence : | |||
| DKEVELHAHPWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKRGTP LYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVHFVGGDMFESL | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 14,139.772 | ||
| Theoretical pI: | 11.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 76.085 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337443.1 | complete | 125 | 420-43(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPPFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,139.772 | ||
| Theoretical pI: | 11.241 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 76.085 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.757 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.208 | ||
| sheet | 0.240 | ||