| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337456.1 | internal | 122 | 367-2(-) |
Amino Acid sequence : | |||
| LCDQGIKVAPFYENEKLKLFARIQGKIPLSKSYFEKVWIVGDGLFKVEQLKPPKGPLFIPFSPSPPNKARDDPLYCPTPSMIAPPSLQNFHFCENWLPRRVMSAAPIPGILHPSEGWNVH EC | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,799.983 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 50.355 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.311 | ||
| sheet | 0.213 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337456.1 | internal | 122 | 367-2(-) |
Amino Acid sequence : | |||
| LCDQGIKVAPFYENEKLKLFARIQGKIPLSKSYFEKVWIVGDGLFKVEQLKPPKGPLFIPFSPSPPNKARDDPLYCPTPSMIAPPSLQNFHFCENWLPRRVMSAAPIPGILHPSEGWNVH EC | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,799.983 | ||
| Theoretical pI: | 8.730 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 50.355 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.311 | ||
| sheet | 0.213 | ||