| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337458.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| KPEPVYPKLPFIRSCSASLAPAIMARLEEAFGAPVLEAYAMTEATHLMASNPLPEDGPHKAGSVGKPVGQEMAILDENGVVQGPNGNGEVCIRGPNVTKGYKNNPEANKSAFLFGWFHTG DLGYFDSDGYLHLVGRIKELINRGGEKISPIEVDAVLLSHPDIAQAVAFGVPDDKYGEEINCAVIPRDGTKVDEEEVSRFCKKNLAA | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,218.934 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 34.345 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.285 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337458.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| KPEPVYPKLPFIRSCSASLAPAIMARLEEAFGAPVLEAYAMTEATHLMASNPLPEDGPHKAGSVGKPVGQEMAILDENGVVQGPNGNGEVCIRGPNVTKGYKNNPEANKSAFLFGWFHTG DLGYFDSDGYLHLVGRIKELINRGGEKISPIEVDAVLLSHPDIAQAVAFGVPDDKYGEEINCAVIPRDGTKVDEEEVSRFCKKNLAA | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,218.934 | ||
| Theoretical pI: | 5.062 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14690 | ||
| Instability index: | 34.345 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.256 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.285 | ||
| sheet | 0.280 | ||