| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337461.1 | 3prime_partial | 151 | 215-667(+) |
Amino Acid sequence : | |||
| MKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGV YTIKVATDPRTLNRVVIYRPSTNIITQLELI | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 11,230.879 | ||
| Theoretical pI: | 9.621 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 51.263 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.356 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337461.1 | complete | 104 | 414-100(-) |
Amino Acid sequence : | |||
| MALLIILFLSMSASNGGNAFILSSSTPKSDGRNLLIFPATLMASKILNWSRICGNASADITTSTFFINSNSLSWSSNSPLTMMAPKDWNSSRRVVLEELGLVKT* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,230.879 | ||
| Theoretical pI: | 9.621 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 51.263 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.356 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337461.1 | 3prime_partial | 151 | 215-667(+) |
Amino Acid sequence : | |||
| MKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGV YTIKVATDPRTLNRVVIYRPSTNIITQLELI | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 11,230.879 | ||
| Theoretical pI: | 9.621 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 51.263 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.356 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337461.1 | complete | 104 | 414-100(-) |
Amino Acid sequence : | |||
| MALLIILFLSMSASNGGNAFILSSSTPKSDGRNLLIFPATLMASKILNWSRICGNASADITTSTFFINSNSLSWSSNSPLTMMAPKDWNSSRRVVLEELGLVKT* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,230.879 | ||
| Theoretical pI: | 9.621 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 51.263 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.356 | ||
| sheet | 0.279 | ||