| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337462.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
| NNPTALKKAQIEIDTVVGVDRLLQESDAPHLPYLNAIIKETFRLHPPIPMLSRKSTSDCVIGGYTIPADTLLFVNIWSMGRNPNIWENPTEFQPERFLEKENAAIDIKGQDFELLPFGTG RRGCPGMLLAIQEVTSVIGTMIQCFDWKLPAGDGSDRVDMTERPGLTAPRAEDLVCCVVPAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,672.067 | ||
| Theoretical pI: | 11.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 61.316 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.243 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337462.1 | 5prime_partial | 148 | 600-154(-) |
Amino Acid sequence : | |||
| NIQIQIIVFYKLETTKASTRGHHTTNQILRPRRREARPLRHVDAVGTVAGGQLPVKALNHGPNHTCHLLNGQQHPRAAPSARPKRKKLEILPFNINGGILLLQKSLRLELRRVFPDVRVP PHRPNVDEQQSVCRNRVAADHAIGGRFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,672.067 | ||
| Theoretical pI: | 11.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 61.316 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.243 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337462.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
| NNPTALKKAQIEIDTVVGVDRLLQESDAPHLPYLNAIIKETFRLHPPIPMLSRKSTSDCVIGGYTIPADTLLFVNIWSMGRNPNIWENPTEFQPERFLEKENAAIDIKGQDFELLPFGTG RRGCPGMLLAIQEVTSVIGTMIQCFDWKLPAGDGSDRVDMTERPGLTAPRAEDLVCCVVPAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 16,672.067 | ||
| Theoretical pI: | 11.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 61.316 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.243 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337462.1 | 5prime_partial | 148 | 600-154(-) |
Amino Acid sequence : | |||
| NIQIQIIVFYKLETTKASTRGHHTTNQILRPRRREARPLRHVDAVGTVAGGQLPVKALNHGPNHTCHLLNGQQHPRAAPSARPKRKKLEILPFNINGGILLLQKSLRLELRRVFPDVRVP PHRPNVDEQQSVCRNRVAADHAIGGRFS* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,672.067 | ||
| Theoretical pI: | 11.608 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 61.316 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.243 | ||
| sheet | 0.209 | ||