Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337471.1 | complete | 176 | 13-543(+) |
Amino Acid sequence : | |||
MINPLRAYMEEAKWCYSKYIPKMDEYMNLALVSGAYMMLATTSLVGILGDPITKQDFDWITNEPPILRAASVICRLMDDVVGHGIEQKISSVDCYMKENGCSKMEAVGEFSKQVKKAWKN LNEEWVEPRAASMVILVRVVNLARVINLLYVGEDSYGNSSVKTKELIKCVLVDPIK* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 19,862.101 | ||
Theoretical pI: | 5.921 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34170 | ||
Instability index: | 34.024 | ||
aromaticity | 0.080 | ||
GRAVY | 0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.210 | ||
sheet | 0.284 |