| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337473.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| GARGKGRKALESKVSAKKISTPPTNKPSLNKKAQIKSGKPENLKTASSLKNQSRIRRVSSNKARNDEKVPEKTIHVISTENGDNAKPSPHGKYSPLTSNQECISECKETDAKADESIPEK KDSTETTKEAPAKEINRKTSRKIRVTVPEEKHTSPVKLKFRMGKVVDLQSDNNSPRKLRFRRARLLGAADDSKGDTRRRTSKRAGINGDTAGTTNPSQKVVLKHQDVQGKKDAQVLLNNV IEETASK | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,195.433 | ||
| Theoretical pI: | 10.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.275 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337473.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| GARGKGRKALESKVSAKKISTPPTNKPSLNKKAQIKSGKPENLKTASSLKNQSRIRRVSSNKARNDEKVPEKTIHVISTENGDNAKPSPHGKYSPLTSNQECISECKETDAKADESIPEK KDSTETTKEAPAKEINRKTSRKIRVTVPEEKHTSPVKLKFRMGKVVDLQSDNNSPRKLRFRRARLLGAADDSKGDTRRRTSKRAGINGDTAGTTNPSQKVVLKHQDVQGKKDAQVLLNNV IEETASK | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 27,195.433 | ||
| Theoretical pI: | 10.178 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.012 | ||
| GRAVY | -1.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.166 | ||
| turn | 0.275 | ||
| sheet | 0.198 | ||