| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337485.1 | internal | 194 | 1-582(+) |
Amino Acid sequence : | |||
| RELVALWAAPNNGSPPITKQDIDLMQFPQHIEHLEADFFLFSGYGYGLDQFAPELAMGGPPPVGAQKANLDPTTQEIVREFGLQEIGHLRALKTMVGGIPRPLLNLSSKNFAKLMNEAFG RELEPPFDPYRDSLSYMMASYVIPYVGLTGYVGTNPNIVGYITKKLLAGLLGVDAGHDAAIRHYLYDRAADQVH | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 21,372.180 | ||
| Theoretical pI: | 5.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 34.702 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.258 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337485.1 | internal | 194 | 1-582(+) |
Amino Acid sequence : | |||
| RELVALWAAPNNGSPPITKQDIDLMQFPQHIEHLEADFFLFSGYGYGLDQFAPELAMGGPPPVGAQKANLDPTTQEIVREFGLQEIGHLRALKTMVGGIPRPLLNLSSKNFAKLMNEAFG RELEPPFDPYRDSLSYMMASYVIPYVGLTGYVGTNPNIVGYITKKLLAGLLGVDAGHDAAIRHYLYDRAADQVH | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 21,372.180 | ||
| Theoretical pI: | 5.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 34.702 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.258 | ||
| sheet | 0.294 | ||