| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337498.1 | 3prime_partial | 166 | 46-543(+) |
Amino Acid sequence : | |||
| MSLLSKLRLITVDVTGTLIAYKGELGDYYCMAAKSIGLPCPDYKRVHEGFKQAYTEMATKHPCFGFSEKIPNIVWWKTCVRDSFIRAGYDYDEETFEKIFRRIYATFGSSAPYTIFPDSK PFLRWLREKDIIVGIVSNAEYRYQDVILPALGLHQGSEWDFGVFSG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,082.695 | ||
| Theoretical pI: | 6.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38640 | ||
| Instability index: | 43.233 | ||
| aromaticity | 0.157 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.205 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337498.1 | 3prime_partial | 166 | 46-543(+) |
Amino Acid sequence : | |||
| MSLLSKLRLITVDVTGTLIAYKGELGDYYCMAAKSIGLPCPDYKRVHEGFKQAYTEMATKHPCFGFSEKIPNIVWWKTCVRDSFIRAGYDYDEETFEKIFRRIYATFGSSAPYTIFPDSK PFLRWLREKDIIVGIVSNAEYRYQDVILPALGLHQGSEWDFGVFSG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,082.695 | ||
| Theoretical pI: | 6.820 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38640 | ||
| Instability index: | 43.233 | ||
| aromaticity | 0.157 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.361 | ||
| turn | 0.205 | ||
| sheet | 0.211 | ||