| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | 3prime_partial | 142 | 112-537(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKRGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTA | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKARPPFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFEDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| LHAQAPLARPKLHQLHGAVCGGGAGDSRHPRRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLEKGDEPLSQV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | 3prime_partial | 142 | 112-537(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKRGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTA | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | complete | 125 | 408-31(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKARPPFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFEDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337503.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
| LHAQAPLARPKLHQLHGAVCGGGAGDSRHPRRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLEKGDEPLSQV DQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,536.236 | ||
| Theoretical pI: | 11.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 67.111 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.668 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.252 | ||
| sheet | 0.301 | ||