| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | 3prime_partial | 183 | 140-688(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFES | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| APLIVPQRSSTSCTSPLARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSL ENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | complete | 125 | 436-59(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | 3prime_partial | 183 | 140-688(+) |
Amino Acid sequence : | |||
| MSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVS NYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFES | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
| APLIVPQRSSTSCTSPLARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSL ENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337505.1 | complete | 125 | 436-59(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,106.923 | ||
| Theoretical pI: | 11.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 71.436 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.681 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.176 | ||
| sheet | 0.264 | ||