| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337507.1 | 5prime_partial | 101 | 373-68(-) |
Amino Acid sequence : | |||
| HEALADLAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDVADEGGDEIKESSKRESGEGGQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,161.162 | ||
| Theoretical pI: | 4.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 52.218 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.218 | ||
| sheet | 0.347 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337507.1 | 5prime_partial | 101 | 373-68(-) |
Amino Acid sequence : | |||
| HEALADLAPTHPIRLGLALNFSVFYYEILNSPDRACTLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWTSDVADEGGDEIKESSKRESGEGGQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,161.162 | ||
| Theoretical pI: | 4.281 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 52.218 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.218 | ||
| sheet | 0.347 | ||