| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337516.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| NLPCPIPYEEIHREALISLKPELFEGLRFDFTKGLNQKFSLSHSVTMGPTEIPAQSSDVIKIPTANYEFGANFIDPKLMLFGRVTTDGRLNARLKCDLTDNLSLKGNAQLTNEPHMSHGM FNFDYKGSDFRTQFQVGNGALFGASYIQSVTPNLSLGGEVFWAGQHRKSGIGYAARYTTDKMVATGQVASTGIVALG | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,569.224 | ||
| Theoretical pI: | 7.137 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 13.356 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.279 | ||
| sheet | 0.239 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337516.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| NLPCPIPYEEIHREALISLKPELFEGLRFDFTKGLNQKFSLSHSVTMGPTEIPAQSSDVIKIPTANYEFGANFIDPKLMLFGRVTTDGRLNARLKCDLTDNLSLKGNAQLTNEPHMSHGM FNFDYKGSDFRTQFQVGNGALFGASYIQSVTPNLSLGGEVFWAGQHRKSGIGYAARYTTDKMVATGQVASTGIVALG | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,569.224 | ||
| Theoretical pI: | 7.137 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 13.356 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.219 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.279 | ||
| sheet | 0.239 | ||