| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337524.1 | internal | 130 | 391-2(-) |
Amino Acid sequence : | |||
| QDQNPPRILRVIIEIFQPPGSQGLIAGLYKEAEIVDPLSRFGFVEYVFRNPSAEIPGCGAECGPILPGGADEEIEKLRNFGLCAGPMRALMEVGNPPEIEKFVRRLKDLAFKEMEGFPGD NPELISTLVA | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 11,494.728 | ||
| Theoretical pI: | 9.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 42.261 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.496 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337524.1 | 5prime_partial | 113 | 3-344(+) |
Amino Acid sequence : | |||
| ATRVEISSGLSPGKPSISLKAKSFNLLTNFSISGGFPTSINALIGPAQSPKFLSFSISSSAPPGNMGPHSAPQPGISAEGFRNTYSTNPNLERGSTISASLYSPAINPCEPGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,494.728 | ||
| Theoretical pI: | 9.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 42.261 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.496 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337524.1 | internal | 130 | 391-2(-) |
Amino Acid sequence : | |||
| QDQNPPRILRVIIEIFQPPGSQGLIAGLYKEAEIVDPLSRFGFVEYVFRNPSAEIPGCGAECGPILPGGADEEIEKLRNFGLCAGPMRALMEVGNPPEIEKFVRRLKDLAFKEMEGFPGD NPELISTLVA | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 11,494.728 | ||
| Theoretical pI: | 9.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 42.261 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.496 | ||
| sheet | 0.195 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337524.1 | 5prime_partial | 113 | 3-344(+) |
Amino Acid sequence : | |||
| ATRVEISSGLSPGKPSISLKAKSFNLLTNFSISGGFPTSINALIGPAQSPKFLSFSISSSAPPGNMGPHSAPQPGISAEGFRNTYSTNPNLERGSTISASLYSPAINPCEPGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 11,494.728 | ||
| Theoretical pI: | 9.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 42.261 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.181 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.496 | ||
| sheet | 0.195 | ||