Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337531.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
VYIFKKVKETLAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGL ATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPKGN | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 19,343.801 | ||
Theoretical pI: | 5.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 58.368 | ||
aromaticity | 0.076 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.211 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337531.1 | 3prime_partial | 171 | 513-1(-) |
Amino Acid sequence : | |||
MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLH LFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRQSLLNFLENIN | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,343.801 | ||
Theoretical pI: | 5.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 58.368 | ||
aromaticity | 0.076 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.211 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337531.1 | internal | 220 | 1-660(+) |
Amino Acid sequence : | |||
VYIFKKVKETLAPGPVLIHIITEKGKGYPPAEVAADKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVVAIHAAMGGGTGLNIFQKRFPDRCFDVGIAEQHAVTFAAGL ATEGLKPFCTIYSSFLQRGYDQVVHDVDLQKLPVRFMMDRAGLVGADGPTHCGAFDTTYMACLPNMVVMAPSDEAELMHMVATAAVIDDRPSCVRYPKGN | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 19,343.801 | ||
Theoretical pI: | 5.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 58.368 | ||
aromaticity | 0.076 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.211 | ||
sheet | 0.275 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337531.1 | 3prime_partial | 171 | 513-1(-) |
Amino Acid sequence : | |||
MCGPIRPHQSSSIHHEPHRKLLEVHVMHHLIVPSLQERRVDRAEWLQPFCGEACSEGDSVLLGDPHVEATVREALLEDVETGSAAHGRVDSDYFVVLLRFGDEGLGEVLCVGFCACFGLH LFPGCWIELHHTMHFICSNFSRRIAFALLRDDVDQHGSRRQSLLNFLENIN | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,343.801 | ||
Theoretical pI: | 5.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12990 | ||
Instability index: | 58.368 | ||
aromaticity | 0.076 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.211 | ||
sheet | 0.275 |