| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337536.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
| AQCVSCCGLAPKLRTLSLSPNAAFKPLTFSSNASTVSLFSRGLASVSPVQLSPNRRSIVCEVAKKKADSAAKRARQAEKRRIYHKAKKSEVRTRMKKVLEAVEVLIKKQEAQPEEVVPLE KLIAEAYSPIDK | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,506.847 | ||
| Theoretical pI: | 10.024 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 59.949 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.212 | ||
| sheet | 0.303 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337536.1 | internal | 132 | 2-397(+) |
Amino Acid sequence : | |||
| AQCVSCCGLAPKLRTLSLSPNAAFKPLTFSSNASTVSLFSRGLASVSPVQLSPNRRSIVCEVAKKKADSAAKRARQAEKRRIYHKAKKSEVRTRMKKVLEAVEVLIKKQEAQPEEVVPLE KLIAEAYSPIDK | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,506.847 | ||
| Theoretical pI: | 10.024 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 59.949 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.258 | ||
| turn | 0.212 | ||
| sheet | 0.303 | ||