| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337548.1 | 5prime_partial | 101 | 542-237(-) |
Amino Acid sequence : | |||
| PFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTFDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,623.041 | ||
| Theoretical pI: | 11.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 36.636 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.396 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337548.1 | 5prime_partial | 101 | 542-237(-) |
Amino Acid sequence : | |||
| PFSLTSTSLNPAGGIISKFETSLAMIRPRMGSARIIPGQLLLPIPNGKNLKSTLPPATAASVPLSSSMNRSGRNSSGFFHHSGLLDSHHAFTTTFDSFGIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,623.041 | ||
| Theoretical pI: | 11.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 36.636 | ||
| aromaticity | 0.069 | ||
| GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.396 | ||
| sheet | 0.218 | ||