| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337549.1 | 5prime_partial | 120 | 411-49(-) |
Amino Acid sequence : | |||
| IPKESKVVVNVWWLSNNPEWWKNPEEFRPERFMEEDSGPEAAVAGGKVEKRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVDVSEKGGQFSLHIANPSTMVFKPIEA * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,420.189 | ||
| Theoretical pI: | 9.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 33.874 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.390 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337549.1 | 3prime_partial | 118 | 59-412(+) |
Amino Acid sequence : | |||
| MGLNTIVEGLAMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSAKIIPGQLLLPIPNGKNLFSTLPPATAASGPLSSSMNRSGRNSSGFFHHSGLLDSHHTFTTTFDSFGI | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,420.189 | ||
| Theoretical pI: | 9.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 33.874 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.390 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337549.1 | 5prime_partial | 120 | 411-49(-) |
Amino Acid sequence : | |||
| IPKESKVVVNVWWLSNNPEWWKNPEEFRPERFMEEDSGPEAAVAGGKVEKRFLPFGMGRRSCPGIILALPILGLIIARLVSNFEIMPPAGLREVDVSEKGGQFSLHIANPSTMVFKPIEA * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,420.189 | ||
| Theoretical pI: | 9.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 33.874 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.390 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337549.1 | 3prime_partial | 118 | 59-412(+) |
Amino Acid sequence : | |||
| MGLNTIVEGLAMCRLNCPPFSLTSTSLNPAGGIISKFETSLAMIRPRMGSAKIIPGQLLLPIPNGKNLFSTLPPATAASGPLSSSMNRSGRNSSGFFHHSGLLDSHHTFTTTFDSFGI | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,420.189 | ||
| Theoretical pI: | 9.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 33.874 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.106 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.390 | ||
| sheet | 0.237 | ||