Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337585.1 | 5prime_partial | 227 | 2-685(+) |
Amino Acid sequence : | |||
HAVKNSPFLERLKKKLYEVLYMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLDDETEEEKKQKEEKKKSFENLCKVMKDILGDKVEKVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQA LRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEADKNDKSVKDLVMLLFETALLTSGFSLDDPNTFASRIHRMLKLGLSIDEAEEEDAEMPALEEESNEESKMEEVD* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 10,956.178 | ||
Theoretical pI: | 5.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 68.328 | ||
aromaticity | 0.182 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.364 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337585.1 | 5prime_partial | 175 | 769-242(-) |
Amino Acid sequence : | |||
HSSFTVQTNGYNQVHTHTQNIRRPYSTDLINLLHLALLVTLFLQGRHLSILLFRLINAQTEFQHTVDPRGEGVGVIQAEPRSKESSLEQQHYQILHRFVILIRLCSLPQLFHDSIVRIYF HRLLARHVRAHAAIPQSLSLHDPLHVGRPPVFTSHQAARGVHYSVRNHHLLHFVA* | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 10,956.178 | ||
Theoretical pI: | 5.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 68.328 | ||
aromaticity | 0.182 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.364 | ||
sheet | 0.172 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337585.1 | complete | 99 | 348-49(-) |
Amino Acid sequence : | |||
MILSMLAVHPYSPVTKQQGESTILSETTTFSTLSPKMSFITLHRFSNDFFFSSFCFFSSSVSSSSFSPSFVAETSFFPSYSFNCPTAYSSMASTMYSTS* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 10,956.178 | ||
Theoretical pI: | 5.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 68.328 | ||
aromaticity | 0.182 | ||
GRAVY | 0.192 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.364 | ||
sheet | 0.172 |