| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337592.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| SPVTICGDILCQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGTANVWKTFTDLFDYFPLTALVESEIFCLHGG LSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHSNSLKLIARAHQLVMEGYNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDNKDHTFIQF EPAPRRGEPDVTRRTPDYF | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,783.194 | ||
| Theoretical pI: | 5.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
| Instability index: | 36.583 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.224 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337592.1 | internal | 259 | 2-778(+) |
Amino Acid sequence : | |||
| SPVTICGDILCQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGTANVWKTFTDLFDYFPLTALVESEIFCLHGG LSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDISEQFNHSNSLKLIARAHQLVMEGYNWAHEQKVVTIFSAPNYCYRCGNMASILEVDDNKDHTFIQF EPAPRRGEPDVTRRTPDYF | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,783.194 | ||
| Theoretical pI: | 5.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43360 | ||
| Instability index: | 36.583 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.367 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.224 | ||
| sheet | 0.193 | ||