| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337606.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
| KLADNSQKFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSILFIGIARAANVFSCAYLVNLVRPANRKIPMQHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATT AIVVLTVLLIGGSTGTMLEALQVVGDGHESALGENFEANNGYTAPMYEGESSSGNRFKMKLKE | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,072.877 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 31.834 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.235 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337606.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
| KLADNSQKFVSAFFHLISSLAETFVFIYMGFDIAMEQHSWSHIGFIFFSILFIGIARAANVFSCAYLVNLVRPANRKIPMQHQKALWYSGLRGAMAFALALQSIHDLPEGHGQTIFTATT AIVVLTVLLIGGSTGTMLEALQVVGDGHESALGENFEANNGYTAPMYEGESSSGNRFKMKLKE | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 20,072.877 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 31.834 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.235 | ||
| sheet | 0.301 | ||