| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337607.1 | 5prime_partial | 102 | 527-219(-) |
Amino Acid sequence : | |||
| GFSTTMAWVVSTIPATEAVFCNAHLVTLAGSITPASRRFSCVSVIALYPNSHSLLLTFSTTTSPSTPAFCAINDAGAINAFWMMSAPRRSSGSSRVSLILGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,659.131 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 57.770 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.314 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337607.1 | 5prime_partial | 102 | 527-219(-) |
Amino Acid sequence : | |||
| GFSTTMAWVVSTIPATEAVFCNAHLVTLAGSITPASRRFSCVSVIALYPNSHSLLLTFSTTTSPSTPAFCAINDAGAINAFWMMSAPRRSSGSSRVSLILGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,659.131 | ||
| Theoretical pI: | 9.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 57.770 | ||
| aromaticity | 0.088 | ||
| GRAVY | 0.525 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.314 | ||
| sheet | 0.245 | ||