Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337608.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
GPYNTTDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALS PGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAM | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 22,254.317 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 41.375 | ||
aromaticity | 0.087 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.251 | ||
sheet | 0.266 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337608.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
GPYNTTDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALS PGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAM | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 22,254.317 | ||
Theoretical pI: | 8.909 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 41.375 | ||
aromaticity | 0.087 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.251 | ||
sheet | 0.266 |