| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337608.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| GPYNTTDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALS PGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAM | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,254.317 | ||
| Theoretical pI: | 8.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
| Instability index: | 41.375 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.251 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337608.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| GPYNTTDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQALS PGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAM | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,254.317 | ||
| Theoretical pI: | 8.909 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
| Instability index: | 41.375 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.251 | ||
| sheet | 0.266 | ||