| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337611.1 | 5prime_partial | 185 | 596-39(-) |
Amino Acid sequence : | |||
| KGEQNSPEFLKENPLHTVPLMNDNGFYLNESRAIITYFANKYGKDDSLYPKDPAKRAIVDEMLYFDIGTLAQRFRDYFFPVMWAGAPAFDDAKKAKLDEALGAFETILEKRTFAAGDSIT VADAALVASVSTFEIAGDLLSPYKNVSAWLAKCKAAIPDYEEENYKGVVSYRDLFHVRTEGKYKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,834.340 | ||
| Theoretical pI: | 5.313 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27390 | ||
| Instability index: | 33.504 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.195 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337611.1 | 5prime_partial | 185 | 596-39(-) |
Amino Acid sequence : | |||
| KGEQNSPEFLKENPLHTVPLMNDNGFYLNESRAIITYFANKYGKDDSLYPKDPAKRAIVDEMLYFDIGTLAQRFRDYFFPVMWAGAPAFDDAKKAKLDEALGAFETILEKRTFAAGDSIT VADAALVASVSTFEIAGDLLSPYKNVSAWLAKCKAAIPDYEEENYKGVVSYRDLFHVRTEGKYKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,834.340 | ||
| Theoretical pI: | 5.313 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27390 | ||
| Instability index: | 33.504 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.195 | ||
| sheet | 0.292 | ||