| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337629.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
| XDQYQFPTISQKVANQLHLRSSLSQDKQARYGAALQPATYQTGFAYGNYTNPGLQYPMTHRATQELSSISANASPIFVQAPQEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ DEMIKAGRLSEPYKGIGDCFKRTIQEEGFGSLWRGNTANGIRYFPTQALNFAFKDYFKRL | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 19,797.156 | ||
| Theoretical pI: | 9.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 32.663 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.246 | ||
| sheet | 0.251 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337629.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
| XDQYQFPTISQKVANQLHLRSSLSQDKQARYGAALQPATYQTGFAYGNYTNPGLQYPMTHRATQELSSISANASPIFVQAPQEKGLAGFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQ DEMIKAGRLSEPYKGIGDCFKRTIQEEGFGSLWRGNTANGIRYFPTQALNFAFKDYFKRL | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 19,797.156 | ||
| Theoretical pI: | 9.459 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 32.663 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.385 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.246 | ||
| sheet | 0.251 | ||