| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337633.1 | 5prime_partial | 232 | 3-701(+) |
Amino Acid sequence : | |||
| LTRILPYKVWISYSRYRTAKGTSRIVDKNIQFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFWRTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV IHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFLPFYDYGYGTMDKSSDALYEELTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 14,464.614 | ||
| Theoretical pI: | 10.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 67.943 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.307 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337633.1 | complete | 127 | 224-607(+) |
Amino Acid sequence : | |||
| MDNFASCWPSGVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPVTDNDMDSNGFNDLVRRLYNLHRFYEQHGPLQLRAHSKTTLLHLPSLKISHLHTFIS LAAPHSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,464.614 | ||
| Theoretical pI: | 10.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 67.943 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.307 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337633.1 | 5prime_partial | 232 | 3-701(+) |
Amino Acid sequence : | |||
| LTRILPYKVWISYSRYRTAKGTSRIVDKNIQFDQVDREKNWDDQIIFNGLLFYLGYSYIKEAHHLPFWRTDGVIWTILLHAGPVEFLYYWLHRALHHHFLYSRYHSHHHSSIVTEPITSV IHPFGEHIAYFALFAIPLLTTIWTRTASMTSFAGYITYIDFMNNMGHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFLPFYDYGYGTMDKSSDALYEELTC* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 14,464.614 | ||
| Theoretical pI: | 10.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 67.943 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.307 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337633.1 | complete | 127 | 224-607(+) |
Amino Acid sequence : | |||
| MDNFASCWPSGVPLLLAPPRPPPPLPLLPLPFPPPLLHRHRAHYVGDPSLRRTHSILRPLRDPVTDNDMDSNGFNDLVRRLYNLHRFYEQHGPLQLRAHSKTTLLHLPSLKISHLHTFIS LAAPHSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,464.614 | ||
| Theoretical pI: | 10.146 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 67.943 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.328 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.307 | ||
| sheet | 0.252 | ||