| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337635.1 | 5prime_partial | 212 | 3-641(+) |
Amino Acid sequence : | |||
| FPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGVYTIKVATDPRAL NRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKEDDVEASTLYPELKFTHDR* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 24,568.023 | ||
| Theoretical pI: | 5.402 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 53.319 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.175 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337635.1 | 5prime_partial | 212 | 3-641(+) |
Amino Acid sequence : | |||
| FPQILDQFKILEAIKVAGNIKRFLPSDFGVEEDRINALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGVYTIKVATDPRAL NRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEIVALTKELPEPENIPIAILHCLFIDGATMSYDFKEDDVEASTLYPELKFTHDR* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 24,568.023 | ||
| Theoretical pI: | 5.402 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 53.319 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.175 | ||
| sheet | 0.264 | ||