| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337665.1 | internal | 172 | 2-517(+) |
Amino Acid sequence : | |||
| KNEDPLNGSVRVHTVLISTQHDETVTNDHIAADLKEHVIKPGIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIGRQAAKSVGAS GLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDIPGTYQGELRLQAGND | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,243.250 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 8.940 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.273 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337665.1 | internal | 172 | 2-517(+) |
Amino Acid sequence : | |||
| KNEDPLNGSVRVHTVLISTQHDETVTNDHIAADLKEHVIKPGIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIGRQAAKSVGAS GLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDIPGTYQGELRLQAGND | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,243.250 | ||
| Theoretical pI: | 7.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 8.940 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.273 | ||
| sheet | 0.174 | ||