| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337670.1 | 3prime_partial | 117 | 352-2(-) |
Amino Acid sequence : | |||
| MERIMKAQALRDSSMAGYMSSKKTMEINPENSIMEELRKRADPDKNDKSVKDLVMLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAADADVDMPALEEADADADGQQDXR | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,317.052 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 66.395 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.380 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337670.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
| XPSCCPSASASASSKAGMSTSASAASSSMLRPSFNILWILLPKVLGSSRLKPEVSRAVSNSSMTKSLTDLSFLSGSARFLSSSMIEFSGLISIVFLLDMYPAMLESLRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,317.052 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 66.395 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.380 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337670.1 | 3prime_partial | 117 | 352-2(-) |
Amino Acid sequence : | |||
| MERIMKAQALRDSSMAGYMSSKKTMEINPENSIMEELRKRADPDKNDKSVKDLVMLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSIDDDAADADVDMPALEEADADADGQQDXR | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 11,317.052 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 66.395 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.380 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337670.1 | 5prime_partial | 109 | 3-332(+) |
Amino Acid sequence : | |||
| XPSCCPSASASASSKAGMSTSASAASSSMLRPSFNILWILLPKVLGSSRLKPEVSRAVSNSSMTKSLTDLSFLSGSARFLSSSMIEFSGLISIVFLLDMYPAMLESLRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,317.052 | ||
| Theoretical pI: | 9.604 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 66.395 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.380 | ||
| sheet | 0.324 | ||