| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337692.1 | complete | 101 | 31-336(+) |
Amino Acid sequence : | |||
| MDDLAPFGKEEKIAAVSCYMKEYGCSEMEASRELWKQVKKAWKDLNDGWMEPRAASSEILACIIDQSRISNNLYSTGEDGFSDSTTRTKQFIKSLLVDRIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,491.877 | ||
| Theoretical pI: | 4.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 53.174 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.558 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.218 | ||
| sheet | 0.277 | ||